Structure of PDB 5lnk Chain z |
>5lnkz (length=69) Species: 9940 (Ovis aries) [Search protein sequence] |
WFEVLPGIAVMGVCLFIPGMATARIHRFSNGGREKRVAHYSYQWYLMERD RRVSGVNRYYVSKGLENID |
|
PDB | 5lnk Atomic structure of the entire mammalian mitochondrial complex I. |
Chain | z |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CDL |
z |
F3 L6 |
F2 L5 |
|
|
|
|