Structure of PDB 5imq Chain z

Receptor sequence
>5imqz (length=64) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVL
AKPEAERIKLLLPY
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chainz
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna z M1 M4 K5 H7 K8 K11 K12 T17 S19 K21 K26 T27 K29 R30 H31 L32 N33 W34 K39 R42 R46 K47 K52 M1 M4 K5 H7 K8 K11 K12 T17 S19 K21 K26 T27 K29 R30 H31 L32 N33 W34 K39 R42 R46 K47 K52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]