Structure of PDB 5b66 Chain z

Receptor sequence
>5b66z (length=61) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIAL
VLVVGVLNFFV
3D structure
PDB5b66 Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
Chainz
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide z F17 I21 P24 V25 A28 S29 P30 F17 I21 P24 V25 A28 S29 P30
BS02 CLA z V20 V23 V20 V23
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0042549 photosystem II stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b66, PDBe:5b66, PDBj:5b66
PDBsum5b66
PubMed28102667
UniProtD0VWR5|PSBZ_THEVL Photosystem II reaction center protein Z (Gene Name=psbZ)

[Back to BioLiP]