Structure of PDB 3jan Chain z

Receptor sequence

>3janz (length=426) Species: 9986 (Oryctolagus cuniculus)

ADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLR
ENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNV
IMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNAT
KARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFE
EMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGH
AKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMQFTLRD
MYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDS
MNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMV
KKMAAAAAAAAAAAAAAAAAAAAAAA

3D structure

• PDB: 3jan Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.
• Chain: z
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	z	K374 T377 I378 D380 S381 M382 N383 Q385 K398 Q399 G401 R402 R405 V406 R408 G409 S410 G411 V412	K343 T346 I347 D349 S350 M351 N352 Q354 K367 Q368 G370 R371 R374 V375 R377 G378 S379 G380 V381

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 11:49:11 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3jan', asym_id = 'z', title = 'Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3jan', asym_id='z', title='Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003924,0005525,0006614,0008312,0016887,0048500', uniprot = '', pdbid = '3jan', asym_id = 'z'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003924,0005525,0006614,0008312,0016887,0048500', uniprot='', pdbid='3jan', asym_id='z')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>