Structure of PDB 9c4g Chain y

Receptor sequence
>9c4gy (length=58) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
MSKLKITQIKSGIATKPNHRETLRSLGLKRIGDTVIKEDRPEFRGMVRTV
RHLVTMEE
3D structure
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Chainy
Resolution2.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y K11 S12 I14 A15 P18 N19 E22 T23 R25 S26 K30 I32 K38 R41 P42 E43 F44 G46 M47 K10 S11 I13 A14 P17 N18 E21 T22 R24 S25 K29 I31 K37 R40 P41 E42 F43 G45 M46
BS02 rna y K17 R52 H53 K16 R51 H52
External links