Structure of PDB 8ipx Chain y

Receptor sequence
>8ipxy (length=165) Species: 9606 (Homo sapiens) [Search protein sequence]
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT
GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKH
SGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD
IIDDINSGAVECPAS
3D structure
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Chainy
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y R16 S76 S78 K96 H100 L121 A122 G127 K130 E131 Q137 S138 R16 S76 S78 K96 H100 L121 A122 G127 K130 E131 Q137 S138
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtP30050|RL12_HUMAN Large ribosomal subunit protein uL11 (Gene Name=RPL12)

[Back to BioLiP]