Structure of PDB 8crx Chain y

Receptor sequence
>8crxy (length=58) Species: 1747 (Cutibacterium acnes) [Search protein sequence]
MSKLKITQIKSGIATKPNHRETLRSLGLKRIGDTVIKEDRPEFRGMVRTV
RHLVTMEE
3D structure
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Chainy
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y K11 S12 I14 A15 P18 N19 R21 E22 T23 R25 S26 K30 I32 K38 P42 E43 F44 G46 K10 S11 I13 A14 P17 N18 R20 E21 T22 R24 S25 K29 I31 K37 P41 E42 F43 G45
BS02 rna y K17 R52 H53 K16 R51 H52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2B7I5Y4

[Back to BioLiP]