Structure of PDB 7w5a Chain y |
>7w5ay (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] |
KRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEF ELAEDAAAAIDNMNESELFGRTIRVNLAK |
|
PDB | 7w5a Mechanism of exon ligation by human spliceosome. |
Chain | y |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
5.2.1.8: peptidylprolyl isomerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
y |
L39 D40 E42 R47 |
L35 D36 E38 R43 |
|
|
|
|