Structure of PDB 7w59 Chain y

Receptor sequence
>7w59y (length=79) Species: 9606 (Homo sapiens) [Search protein sequence]
KRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEF
ELAEDAAAAIDNMNESELFGRTIRVNLAK
3D structure
PDB7w59 Mechanism of exon ligation by human spliceosome.
Chainy
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y D40 E42 T43 R47 D36 E38 T39 R43
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0005515 protein binding
GO:0008143 poly(A) binding
GO:0016018 cyclosporin A binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006355 regulation of DNA-templated transcription
GO:0006397 mRNA processing
GO:0006457 protein folding
GO:0008380 RNA splicing
GO:0045070 positive regulation of viral genome replication
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016607 nuclear speck
GO:0034774 secretory granule lumen
GO:0043231 intracellular membrane-bounded organelle
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E (Gene Name=PPIE)

[Back to BioLiP]