Structure of PDB 7q0p Chain y

Receptor sequence

>7q0py (length=185) Species: 237561 (Candida albicans SC5314)

GRDHTSKQHVRSGHRTAPKSDNVYLQLLVKLYSFLARRTDAPFNKVILKS
LFLSKINRPPVSVSRISRALKQKGAAEKTIVVVGTVTDDNRLLEFPKATI
AALRFTAGAKDRILKNGGEAITLDQLALRAPKGQNTLIVRGPRNSREAVR
HFGFGPHKGKAPRILSKGRKFERARGRRRSRGFKV

3D structure

• PDB: 7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: y
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	y	G2 R3 H5 S7 K8 Q9 H10 V11 R12 S13 G14 H15 R16 K20 S21 Q27 F35 R38 R39 P43 F44 V47 L54 S55 K56 I57 N58 P61 S63 S65 R66 R69 Q73 K74 K79 T86 T88 D89 D90 N91 R92 T107 A108 G134 Q135 N136 T137 I139 R141 P143 R144 N145 S146 R147 E148 A149 R151 F153 G154 P157 H158 G160 K161 A162 P163 R164 S167 K168 R170 K171 F172 R176 R178 R179 R180 S181 R182 F184 K185 V186	G1 R2 H4 S6 K7 Q8 H9 V10 R11 S12 G13 H14 R15 K19 S20 Q26 F34 R37 R38 P42 F43 V46 L53 S54 K55 I56 N57 P60 S62 S64 R65 R68 Q72 K73 K78 T85 T87 D88 D89 N90 R91 T106 A107 G133 Q134 N135 T136 I138 R140 P142 R143 N144 S145 R146 E147 A148 R150 F152 G153 P156 H157 G159 K160 A161 P162 R163 S166 K167 R169 K170 F171 R175 R177 R178 R179 S180 R181 F183 K184 V185

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
• PDBsum: 7q0p
• PubMed: 35613268
• UniProt: A0A1D8PK43|RL18_CANAL Large ribosomal subunit protein eL18 (Gene Name=RPL18)