Structure of PDB 7pkt Chain y

Receptor sequence

>7pkty (length=71) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

ATPKKKLSLHRRGNRRVWYWLKRKTEVAKCSYCGALSGRNQMFSGAAGNS
ACTGQCVEQAPTPPASSYPAE

3D structure

PDB

7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	y	L56 R59	L9 R12
BS02	rna	y	P50 K53 L54 R59 R62 R63 A93	P3 K6 L7 R12 R15 R16 A46
BS03	rna	y	T49 P50 K51 K52 K53 S55 R58 N61	T2 P3 K4 K5 K6 S8 R11 N14
BS04	rna	y	A48 T49 P50 R62 T72 E73 R86 N87	A1 T2 P3 R15 T25 E26 R39 N40
BS05	ZN	y	C77 C80	C30 C33

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links