Structure of PDB 7p6z Chain y

Receptor sequence
>7p6zy (length=56) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
AVQQRRSSKHRRDKRRSHDALTAQALSVCQKCGKKKLFHRVCSCGMYGDL
RVKKAY
3D structure
PDB7p6z Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainy
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y A2 V3 Q4 Q5 R6 R7 S8 S9 H11 R12 R13 D14 K15 R16 R17 S18 H19 A26 S28 K37 F39 H40 Y48 A1 V2 Q3 Q4 R5 R6 S7 S8 H10 R11 R12 D13 K14 R15 R16 S17 H18 A25 S27 K36 F38 H39 Y47
BS02 ZN y C30 C43 C45 C29 C42 C44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p6z, PDBe:7p6z, PDBj:7p6z
PDBsum7p6z
PubMed36171285
UniProtP75238|RL32_MYCPN Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]