Structure of PDB 7naf Chain y

Receptor sequence
>7nafy (length=167) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
MATRTQFENSNEIGVFSKLCLVAVGGSENFYSAFVHTTIAGTRIIGRMTA
GNLLVPTQTTDQELQHLQRVEERLSALGNVICCNDYVALVHPDIDRETEE
LIEVFRQTISGNILVGSYCSGLVHPQTSVQDQLVAGTVNRGSSVVGAGMV
VLAVTGLDTTAPELSVI
3D structure
PDB7naf Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Chainy
Resolution3.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna y E8 N9 N33 E8 N9 N29
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
GO:0043023 ribosomal large subunit binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:0006412 translation
GO:0006413 translational initiation
GO:0042254 ribosome biogenesis
GO:0042256 cytosolic ribosome assembly
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7naf, PDBe:7naf, PDBj:7naf
PDBsum7naf
PubMed36482249
UniProtQ12522|IF6_YEAST Eukaryotic translation initiation factor 6 (Gene Name=TIF6)

[Back to BioLiP]