Structure of PDB 6gqb Chain y

Receptor sequence

>6gqby (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKKSKNAERKWAARAASAKIESSVESQFSA
GRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

• PDB: 6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: y
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	y	S161 K200	S149 K188
BS02	rna	y	G2 I3 R5 K10 R11 T14 G15 A19 R22 K23 K24 R25 K26 F27 L29 G30 R31 Q32 P33 R42 I43 R47 T48 R49 G50 G51 K54 R56 N64 A68 G71 I72 S73 K75 S86 N87 T97 K98 S136 K137 N138 R141 K142 S171 R172 G174 Q175 S176 R178 D180	G1 I2 R4 K9 R10 T13 G14 A18 R21 K22 K23 R24 K25 F26 L28 G29 R30 Q31 P32 R41 I42 R46 T47 R48 G49 G50 K53 R55 N63 A67 G70 I71 S72 K74 S85 N86 T96 K97 S124 K125 N126 R129 K130 S159 R160 G162 Q163 S164 R166 D168

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
• PDBsum: 6gqb
• PubMed: 29886014
• UniProt: P0CX39|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)