Structure of PDB 6fti Chain y

Receptor sequence
>6ftiy (length=62) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKL
IHIPINNIIVGG
3D structure
PDB6fti Structural basis for coupling protein transport and N-glycosylation at the mammalian endoplasmic reticulum.
Chainy
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide y I65 G68 I59 G62
BS02 peptide y I46 I57 I40 I51
Gene Ontology
Molecular Function
GO:0005543 phospholipid binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0022406 membrane docking
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0045047 protein targeting to ER
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0071261 Ssh1 translocon complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6fti, PDBe:6fti, PDBj:6fti
PDBsum6fti
PubMed29519914
UniProtP60058|SC61G_CANLF Protein transport protein Sec61 subunit gamma (Gene Name=SEC61G)

[Back to BioLiP]