Structure of PDB 8rg0 Chain x |
>8rg0x (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] |
CAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYSQYAYFHEE DESSFQLVDTART |
|
PDB | 8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining |
Chain | x |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
x |
D52 K53 R54 |
D34 K35 R36 |
|
|
|