Structure of PDB 8pk0 Chain x

Receptor sequence

>8pk0x (length=338) Species: 9606 (Homo sapiens)

TEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAW
DHVSAKLEQLSAKDFVNEAISHWELQSWACSPNLRCFTFDRGDISRFPPA
RPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTG
CCRNLAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGELE
GDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAG
LLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLTHFR
RVFMDTFCFFSSCQVGELVIPNLMANFGPMYFCKMRRL

3D structure

• PDB: 8pk0 Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
• Chain: x
• Resolution: 3.03 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	x	K37 P207 S208 H218	K4 P162 S163 H173
BS02	SAM	x	C181 A182 A183 K187 D204 L205 R209 G238 D255 P257 L291	C136 A137 A138 K142 D159 L160 R164 G193 D210 P212 L246

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008173 RNA methyltransferase activity
• GO:0008649 rRNA methyltransferase activity
• GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
• GO:0009383 rRNA (cytosine-C5-)-methyltransferase activity
• GO:0016428 tRNA (cytidine-5-)-methyltransferase activity
• GO:0019843 rRNA binding

Biological Process

• GO:0001510 RNA methylation
• GO:0006364 rRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005762 mitochondrial large ribosomal subunit

External links

• PDB: RCSB:8pk0, PDBe:8pk0, PDBj:8pk0
• PDBsum: 8pk0
• PubMed: 38042949
• UniProt: Q96CB9|NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 (Gene Name=NSUN4)