Structure of PDB 8j6z Chain x

Receptor sequence

>8j6zx (length=219) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

SPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRE
LEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYL
GNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFD
PLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADH
LADPVNNNAWAFATNFVPG

3D structure

PDB

8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)

Chain

Resolution

2.79 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	x	L117 V118 H119 A120 Q121	L105 V106 H107 A108 Q109
BS02	CHL	x	W96 F97 G100 S101 F104 Q130 F195	W84 F85 G88 S89 F92 Q118 F183
BS03	CLA	x	M72 Y156 P157 G158 F161 L166 L176 E180	M60 Y144 P145 G146 F149 L154 L164 E168
BS04	CHL	x	H67 W70 Q130 M134 G135 E138 R141	H55 W58 Q118 M122 G123 E126 R129
BS05	CLA	x	L76 G77 F80 F91 Y111	L64 G65 F68 F79 Y99
BS06	CLA	x	K179 N183	K167 N171
BS07	CHL	x	Y23 L24 F27 Y43	Y11 L12 F15 Y31
BS08	CLA	x	G41 D42 Y43 W45 D46 S51 N60 E64 R185 M188	G29 D30 Y31 W33 D34 S39 N48 E52 R173 M176
BS09	CHL	x	R69 W70 Y140 R141 G146 P147 L148 P157 F161	R57 W58 Y128 R129 G134 P135 L136 P145 F149
BS10	CLA	x	W15 K179 K182	W3 K167 K170
BS11	CLA	x	F189 F192 V196 Q197 N208 H212 N219 A221	F177 F180 V184 Q185 N196 H200 N207 A209
BS12	CLA	x	L213 N220	L201 N208
BS13	CLA	x	L63 H67	L51 H55
BS14	CHL	x	A225 F228 V229 P230	A213 F216 V217 P218

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0016168	chlorophyll binding
GO:0046872	metal ion binding

	Biological Process
GO:0009750	response to fructose
GO:0009765	photosynthesis, light harvesting
GO:0015979	photosynthesis

	Cellular Component
GO:0005634	nucleus
GO:0005794	Golgi apparatus
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0048046	apoplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum	8j6z
PubMed	37936349
UniProt	P0CJ48\|CB1A_ARATH Chlorophyll a-b binding protein 2, chloroplastic (Gene Name=LHCB1.1)

[Back to BioLiP]