Structure of PDB 8bgh Chain x

Receptor sequence
>8bghx (length=86) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB8bgh Modulation of translational decoding by m 6 A modification of mRNA.
Chainx
Resolution2.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna x N3 I4 K5 K9 R10 R18 N21 R25 S26 M27 R29 T30 K33 K34 Q55 D59 R60 K64 R74 K76 N2 I3 K4 K8 R9 R17 N20 R24 S25 M26 R28 T29 K32 K33 Q54 D58 R59 K63 R73 K75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bgh, PDBe:8bgh, PDBj:8bgh
PDBsum8bgh
PubMed37553384
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]