Structure of PDB 7vor Chain x |
>7vorx (length=68) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence] |
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVV GRMLPIQENQAPAPNITG |
|
PDB | 7vor Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex. |
Chain | x |
Resolution | 2.74 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SPO |
x |
R20 V23 A24 M27 |
R19 V22 A23 M26 |
|
|
|
|