Structure of PDB 7tnq Chain x |
>7tnqx (length=143) Species: 508771 (Toxoplasma gondii ME49) [Search protein sequence] |
VVKRTQQGNYVPVRPDHFAGVSVALFFAKAGHSKCAQIVPVVRQFYKTTN FSGEKAVIEIIYVSLDKDEQDFERVRALMPWCSVEYKSCLRKKLIERYRV PNSTAIPLLIVIGPNGEEAGRMNFQQSDEFVLQRWDYRFNKWP |
|
PDB | 7tnq Cryo-ET of Toxoplasma parasites gives subnanometer insight into tubulin-based structures. |
Chain | x |
Resolution | 8.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
x |
N137 E139 E140 |
N115 E117 E118 |
|
|
|
|