Structure of PDB 7q08 Chain x

Receptor sequence

>7q08x (length=172) Species: 237561 (Candida albicans SC5314)

VRYAATPANPAKSASARGSYLRVSFKNTRETAQAINGWKLEKAQKYLDQV
LDHQRAIPFRRYNSSIGRTGQGKEFGVTKARWPAKSVNFVKDLLRNAQAN
AEAKGLDSSKLVISHIQVNHAPKQRRRTYRAHGRINAYQSTPSHIELTLT
EEQIRLNSRQRGRLASQKRLTA

3D structure

• PDB: 7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: x
• Resolution: 2.56 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	x	V2 R3 Y4 S16 R18 Y21 R23 S25 K27 R30 Q34 Q55 R62 Y63 S65 S66 I67 G68 R69 G71 Q72 K74 K80 R82 W83 A85 K86 N97 N101 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 A138 Y139 Q140 S141 R167 N169 S170 R171 Q172 G174 R175 S178 R181 L182	V1 R2 Y3 S15 R17 Y20 R22 S24 K26 R29 Q33 Q54 R61 Y62 S64 S65 I66 G67 R68 G70 Q71 K73 K79 R81 W82 A84 K85 N96 N100 Q117 V118 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 A137 Y138 Q139 S140 R155 N157 S158 R159 Q160 G162 R163 S166 R169 L170
BS02	rna	x	R3 A5 R61 R62 N120 H121 P123 H145	R2 A4 R60 R61 N119 H120 P122 H144

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0009986 cell surface
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q08, PDBe:7q08, PDBj:7q08
• PDBsum: 7q08
• PubMed: 35613268
• UniProt: Q59TE0|RL17B_CANAL Large ribosomal subunit protein uL22 (Gene Name=RPL17B)