Structure of PDB 7oig Chain x

Receptor sequence
>7oigx (length=86) Species: 562 (Escherichia coli) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB7oig A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
Chainx
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna x A2 N3 I4 K5 S6 K9 R10 Q13 R18 H20 N21 R25 S26 R29 T30 K33 K34 Y36 Q55 P56 D59 R60 K64 K69 N70 K71 R74 H75 K76 A77 N78 A1 N2 I3 K4 S5 K8 R9 Q12 R17 H19 N20 R24 S25 R28 T29 K32 K33 Y35 Q54 P55 D58 R59 K63 K68 N69 K70 R73 H74 K75 A76 N77
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Apr 19 09:44:45 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oig', asym_id = 'x', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oig', asym_id='x', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '7oig', asym_id = 'x'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='7oig', asym_id='x')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>