Structure of PDB 7ohs Chain x

Receptor sequence

>7ohsx (length=267) Species: 559292 (Saccharomyces cerevisiae S288C)

NKLKRQEIFADIKHEKNKERHTMRRKRAKEERENPELREQRLKENVTQTI
ENTRVYEDDLMRYFNSNSNEPPKIFLTTNVNAKKSAYEFANILIEILPNV
TFVKRKFGYKLKEISDICIKRNFTDIVIINEDKKKVTGLTFIHLPEGPTF
YFKLSSFVEHGRPTSHIPELILNNFQTRLGQTVGRLFQSILPQNPDIEGR
QVITLHNQRDYIFFRRHRYVFKDNERVGLQELGPQFTLKLKRLQRGIKEE
TEWEHKPEMDKEKKKFY

3D structure

• PDB: 7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: x
• Resolution: 4.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	x	N11 K12 L13 K14 Q16 F19 K23 H24 K28 H31 R34 R48 N55 V56 T57 Q58 T59 I60 N102 A103 K104 K105 Y108 K125 F128 K155 R189 K283 P284 K290 K291	N1 K2 L3 K4 Q6 F9 K13 H14 K18 H21 R24 R38 N45 V46 T47 Q48 T49 I50 N81 A82 K83 K84 Y87 K104 F107 K134 R162 K256 P257 K263 K264

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0042134 rRNA primary transcript binding

Biological Process

• GO:0000055 ribosomal large subunit export from nucleus
• GO:0000460 maturation of 5.8S rRNA
• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0030687 preribosome, large subunit precursor

External links

• PDB: RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
• PDBsum: 7ohs
• PubMed: 34813592
• UniProt: P38805|RPF1_YEAST Ribosome production factor 1 (Gene Name=RPF1)