Structure of PDB 7egc Chain x

Receptor sequence

>7egcx (length=64) Species: 9823 (Sus scrofa)

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL
AHVDLIEKLLNYAP

3D structure

• PDB: 7egc Structural insights into preinitiation complex assembly on core promoters.
• Chain: x
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	x	C7 C10	C7 C10

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 23:13:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7egc', asym_id = 'x', title = 'Structural insights into preinitiation complex assembly on core promoters.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7egc', asym_id='x', title='Structural insights into preinitiation complex assembly on core promoters.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0003899,0006351,0008270', uniprot = '', pdbid = '7egc', asym_id = 'x'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003899,0006351,0008270', uniprot='', pdbid='7egc', asym_id='x')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>