Structure of PDB 6frk Chain x

Receptor sequence

>6frkx (length=374) Species: 9615 (Canis lupus familiaris) [Search protein sequence]

NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFK
ELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWK
TCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKN
ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA
QAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDD
FEPFKTQPFISKLLGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFM
SKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGS
GVSTRDVQELLTQYTKFAQMVKKM

3D structure

PDB

6frk Structure of a prehandover mammalian ribosomal SRP·SRP receptor targeting complex.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.4: signal-recognition-particle GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	x	N70 T377 D380 S381 M382 N383 Q399 R402 R405 G409 S410 G411	N39 T317 D320 S321 M322 N323 Q339 R342 R345 G349 S350 G351
BS02	peptide	x	L349 F355 M430	L289 F295 M370
BS03	GNP	x	Q110 G111 G113 K114 T115 T116 K120 R141 K249 D251 G274 G276 E277	Q79 G80 G82 K83 T84 T85 K89 R110 K218 D220 G243 G245 E246
BS04	MG	x	T115 D138	T84 D107

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003924	GTPase activity
GO:0005525	GTP binding
GO:0008312	7S RNA binding
GO:0016787	hydrolase activity
GO:0016887	ATP hydrolysis activity
GO:0019003	GDP binding
GO:0030942	endoplasmic reticulum signal peptide binding

	Biological Process
GO:0006614	SRP-dependent cotranslational protein targeting to membrane
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation
GO:0006617	SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
GO:0030593	neutrophil chemotaxis
GO:0030851	granulocyte differentiation
GO:0031017	exocrine pancreas development
GO:0045047	protein targeting to ER

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005786	signal recognition particle, endoplasmic reticulum targeting
GO:0005829	cytosol
GO:0016607	nuclear speck
GO:0048500	signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6frk, PDBe:6frk, PDBj:6frk
PDBsum	6frk
PubMed	29567807
UniProt	P61010\|SRP54_CANLF Signal recognition particle subunit SRP54 (Gene Name=SRP54)

[Back to BioLiP]