Structure of PDB 1ml5 Chain x |
>1ml5x (length=60) Species: 562 (Escherichia coli) [Search protein sequence] |
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKV AHLVRVEVVE |
|
PDB | 1ml5 Structure of the Escherichia coli ribosomal termination complex with release factor 2 |
Chain | x |
Resolution | 14.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
x |
S11 P16 |
S11 P16 |
|
|
|
|