Structure of PDB 8ipb Chain wa

Receptor sequence
>8ipbwa (length=39) Species: 4565 (Triticum aestivum) [Search protein sequence]
SRVCRVCGNSHGLIRKYGLMCCRQCFRSNAKDIGFIKYR
3D structure
PDB8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
Chainwa
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna wa R19 C24 N26 S27 H28 G29 L30 R32 Y34 R40 Q41 R44 Y55 R56 R2 C7 N9 S10 H11 G12 L13 R15 Y17 R23 Q24 R27 Y38 R39
BS02 ZN wa C21 C24 C39 C42 C4 C7 C22 C25
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
PDBsum8ipb
PubMed38267667
UniProtA0A3B6LU46

[Back to BioLiP]