Structure of PDB 8wid Chain w

Receptor sequence

>8widw (length=126) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

MDVDVSTDGELPGAAEYAREKIGRLSRRAHRPVLHARVRLTRHGDPAVER
PVIAQANLDVNGRQVRAQVEGVNAREAVDRLEARLRSRLERIAEHWEARR
GGVPAEAGREWRHESEPARRPGYFPR

3D structure

PDB

8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	S6 T7 K21 R27 R28 H30 R37 R39 D45 A47 Q55 G62 R66 A67 Q68 R75 E76 D79 R80 R84 R86 R91 W96 E97 A98 R100 G101 E110 W111 R112 H113 P121 F124	S6 T7 K21 R27 R28 H30 R37 R39 D45 A47 Q55 G62 R66 A67 Q68 R75 E76 D79 R80 R84 R86 R91 W96 E97 A98 R100 G101 E110 W111 R112 H113 P121 F124
BS02	rna	w	R31 E94	R31 E94

Gene Ontology

	Molecular Function
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation

	Cellular Component
GO:0022627	cytosolic small ribosomal subunit

External links