Structure of PDB 8wi9 Chain w

Receptor sequence

>8wi9w (length=255) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

MDVDVSTDGELPGAAEYAREKIGRLSRRAHRPVLHARVRLTRHGDPAVER
PVIAQANLDVNGRQVRAQVEGVNAREAVDRLEARLRSRLERIAEHWEARR
GGVPAEAGREWRHESEPARRPGYFPRPPEERRIIRRKSFSMVPCTVDEAA
LEMEMLDYDFHLFTEKGTGFAAVLYKGGPTGYRLVLVIPVPADELSPFEK
PITISTHPAPCLTQRDAVERLGLLGLPFLFYIDAAEGRASVIYRRYDGHY
GLITP

3D structure

PDB

8wi9 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	S6 K21 R27 R28 H30 R37 R39 D45 A47 Q55 G62 R66 R75 E76 D79 R80 R84 R91 W96 E97 A98 R100 G101 E110 W111 R112 H113 E114 A118 P121 Y123 F124 P125 Y246 D247	S6 K21 R27 R28 H30 R37 R39 D45 A47 Q55 G62 R66 R75 E76 D79 R80 R84 R91 W96 E97 A98 R100 G101 E110 W111 R112 H113 E114 A118 P121 Y123 F124 P125 Y246 D247

Gene Ontology

	Molecular Function
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation

	Cellular Component
GO:0022627	cytosolic small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wi9, PDBe:8wi9, PDBj:8wi9
PDBsum	8wi9
PubMed	38245551
UniProt	A0QZ86

[Back to BioLiP]