Structure of PDB 8uu7 Chain w

Receptor sequence

>8uu7w (length=100) Species: 1642 (Listeria innocua) [Search protein sequence]

MLKYNIRGENIEVTEPIRDYVEKKIDKLERYFTETPDANVHVNLKVYSDK
NAKVEVTIPLPNLVLRAEETSGDLYASIDLIVDKLERQIRKHKTKVNRKF

3D structure

PDB

8uu7 Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	N5 R7 K24 K27 R30 T33 Y47 S48 D49 K50 R66 A76 D79 R87 Q88 R90 K91 T94 F100	N5 R7 K24 K27 R30 T33 Y47 S48 D49 K50 R66 A76 D79 R87 Q88 R90 K91 T94 F100

Gene Ontology

	Molecular Function
GO:0043024	ribosomal small subunit binding

	Biological Process
GO:0006417	regulation of translation
GO:0044238	primary metabolic process
GO:0045900	negative regulation of translational elongation

	Cellular Component
GO:0005737	cytoplasm
GO:0022627	cytosolic small ribosomal subunit

External links