Structure of PDB 8q5i Chain w

Receptor sequence

>8q5iw (length=199) Species: 5476 (Candida albicans)

SSFEKVVVIDGKGHLLGRLASIVSKQILNGQKVVVVRCEELNISGEFFRN
KLKYHDYLRKATRYNKKKGPFHFRAPSRILYKAIRGMIPHKTARGKAALE
RLKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYE
SVVEKLEEKRKVQSAEYYAKKKALTKKLNAAKASTAESEAAQKLAAFGY

3D structure

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Chain: w
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	K6 V7 K13 G18 R19 S22 K26 R38 S45 E47 F49 R50 L53 H56 R60 K61 A62 T63 R64 Y65 N66 K67 K69 P71 F72 H73 F74 R75 K83 A84 R86 G87 M88 P90 H91 K92 A94 R95 R102 F106 G108 V109 P110 D114 K115 K116 Q123 V127 R129 L130 K131 P132 R134 K135 V146 G147 K149 Y150 L157 E158 K160 S165 Y168 Y169 K172	K5 V6 K12 G17 R18 S21 K25 R37 S44 E46 F48 R49 L52 H55 R59 K60 A61 T62 R63 Y64 N65 K66 K68 P70 F71 H72 F73 R74 K82 A83 R85 G86 M87 P89 H90 K91 A93 R94 R101 F105 G107 V108 P109 D113 K114 K115 Q122 V126 R128 L129 K130 P131 R133 K134 V145 G146 K148 Y149 L156 E157 K159 S164 Y167 Y168 K171

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: A0A8H6BZ56