Structure of PDB 8cre Chain w

Receptor sequence

>8crew (length=199) Species: 5476 (Candida albicans) [Search protein sequence]

SSFEKVVVIDGKGHLLGRLASIVSKQILNGQKVVVVRCEELNISGEFFRN
KLKYHDYLRKATRYNKKKGPFHFRAPSRILYKAIRGMIPHKTARGKAALE
RLKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYE
SVVEKLEEKRKVQSAEYYAKKKALTKKLNAAKASTAESEAAQKLAAFGY

3D structure

PDB

8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	K6 K13 L17 G18 R19 S22 K26 L29 R38 S45 E47 F49 R50 H56 R60 K61 A62 T63 R64 Y65 N66 K67 P71 F72 H73 F74 R75 A84 R86 G87 M88 P90 H91 K92 T93 A94 R95 R102 F106 V109 P110 P111 Y113 D114 K115 K116 K117 R118 V127 R129 L130 K131 P132 R134 K135 K149 Y150 L157 E158 K160 R161 K162 S165 Y168 Y169 K172 K173	K5 K12 L16 G17 R18 S21 K25 L28 R37 S44 E46 F48 R49 H55 R59 K60 A61 T62 R63 Y64 N65 K66 P70 F71 H72 F73 R74 A83 R85 G86 M87 P89 H90 K91 T92 A93 R94 R101 F105 V108 P109 P110 Y112 D113 K114 K115 K116 R117 V126 R128 L129 K130 P131 R133 K134 K148 Y149 L156 E157 K159 R160 K161 S164 Y167 Y168 K171 K172
BS02	MG	w	Y58 F74	Y57 F73

External links

PDB	RCSB:8cre, PDBe:8cre, PDBj:8cre
PDBsum	8cre
PubMed
UniProt	A0A8H6BZ56

[Back to BioLiP]