Structure of PDB 8cmj Chain w

Receptor sequence

>8cmjw (length=100) Species: 4932 (Saccharomyces cerevisiae)

IIKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTR
KTPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVV

3D structure

• PDB: 8cmj Cryo-EM analysis of eukaryotic ribosome translocation intermediates
• Chain: w
• Resolution: 3.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	E35 K53 G54 P55 V56 R57 L58 P59 K61 K64 S66 T70 P71 N72 G73 E74 G75 S76 K77 T78 W79 E80 R85 K88 Y90	E17 K35 G36 P37 V38 R39 L40 P41 K43 K46 S48 T52 P53 N54 G55 E56 G57 S58 K59 T60 W61 E62 R67 K70 Y72

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:26:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8cmj', asym_id = 'w', title = 'Cryo-EM analysis of eukaryotic ribosome translocation intermediates'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8cmj', asym_id='w', title='Cryo-EM analysis of eukaryotic ribosome translocation intermediates')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '8cmj', asym_id = 'w'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='8cmj', asym_id='w')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>