Structure of PDB 8c3a Chain w

Receptor sequence

>8c3aw (length=199) Species: 5476 (Candida albicans)

SSFEKVVVIDGKGHLLGRLASIVSKQILNGQKVVVVRCEELNISGEFFRN
KLKYHDYLRKATRYNKKKGPFHFRAPSRILYKAIRGMIPHKTARGKAALE
RLKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSSAVGWKYE
SVVEKLEEKRKVQSAEYYAKKKALTKKLNAAKASTAESEAAQKLAAFGY

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: w
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	K6 K13 G18 R19 S22 K26 L29 R38 S45 E47 F49 R50 R60 K61 A62 T63 R64 Y65 K67 K69 P71 F72 H73 F74 R75 A84 R86 G87 M88 P90 H91 K92 T93 A94 R95 A98 R102 F106 V109 P110 P111 Y113 D114 K115 K116 K117 R118 V127 R129 L130 K131 R134 K135 Y150 L157 E158 K160 R161 K162 S165 Y168 Y169 K172 K173	K5 K12 G17 R18 S21 K25 L28 R37 S44 E46 F48 R49 R59 K60 A61 T62 R63 Y64 K66 K68 P70 F71 H72 F73 R74 A83 R85 G86 M87 P89 H90 K91 T92 A93 R94 A97 R101 F105 V108 P109 P110 Y112 D113 K114 K115 K116 R117 V126 R128 L129 K130 R133 K134 Y149 L156 E157 K159 R160 K161 S164 Y167 Y168 K171 K172
BS02	MG	w	F74 K83	F73 K82

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A8H6BZ56