Structure of PDB 7uig Chain w

Receptor sequence
>7uigw (length=103) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNP
PYSQCIVYPNCLFILKLLNGFMESALEGLDELPKIIQLQGPQWMNEMVER
WAN
3D structure
PDB7uig Structural basis of a transcription pre-initiation complex on a divergent promoter.
Chainw
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide w D104 K108 D80 K84
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006311 meiotic gene conversion
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uig, PDBe:7uig, PDBj:7uig
PDBsum7uig
PubMed36731470
UniProtP38633|MED31_YEAST Mediator of RNA polymerase II transcription subunit 31 (Gene Name=SOH1)

[Back to BioLiP]