Structure of PDB 7tnq Chain w |
>7tnqw (length=143) Species: 508771 (Toxoplasma gondii ME49) [Search protein sequence] |
VVKRTQQGNYVPVRPDHFAGVSVALFFAKAGHSKCAQIVPVVRQFYKTTN FSGEKAVIEIIYVSLDKDEQDFERVRALMPWCSVEYKSCLRKKLIERYRV PNSTAIPLLIVIGPNGEEAGRMNFQQSDEFVLQRWDYRFNKWP |
|
PDB | 7tnq Cryo-ET of Toxoplasma parasites gives subnanometer insight into tubulin-based structures. |
Chain | w |
Resolution | 8.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
w |
E139 A141 |
E117 A119 |
|
|
|
|