Structure of PDB 7pir Chain w

Receptor sequence

>7pirw (length=100) Species: 272634 (Mycoplasmoides pneumoniae M129)

TVAKELRQKSSEELVKLVIKLKGELLEYRFKLAHGELDKPHLINQTRRLL
ATILTILTERKLNWQEEQAKNEAAVNAWKQHLEANKAKLLKSRAKREDAS

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: w
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	T2 V3 A4 K5 E6 K40 P41 H42 N45 Q46 R48 R49 A52 T53 L55 T56 I57 T59 E60 W65 E67 E68 K71 K95 K97 K100 S101 K104 R105 D107 A108 S109	T1 V2 A3 K4 E5 K39 P40 H41 N44 Q45 R47 R48 A51 T52 L54 T55 I56 T58 E59 W64 E66 E67 K70 K86 K88 K91 S92 K95 R96 D98 A99 S100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: Q50310|RL29_MYCPN Large ribosomal subunit protein uL29 (Gene Name=rpmC)