Structure of PDB 7pai Chain w

Receptor sequence
>7paiw (length=100) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
TVAKELRQKSSEELVKLVIKLKGELLEYRFKLAHGELDKPHLINQTRRLL
ATILTILTERKLNWQEEQAKNEAAVNAWKQHLEANKAKLLKSRAKREDAS
3D structure
PDB7pai Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainw
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w V3 P41 H42 I44 R49 L51 A52 T53 L55 T56 W65 K95 S101 K104 R105 V2 P40 H41 I43 R48 L50 A51 T52 L54 T55 W64 K86 S92 K95 R96
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pai, PDBe:7pai, PDBj:7pai
PDBsum7pai
PubMed36171285
UniProtQ50310|RL29_MYCPN Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]