Structure of PDB 7oui Chain w |
>7ouiw (length=54) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
LVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEES GLSL |
|
PDB | 7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction. |
Chain | w |
Resolution | 2.79 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
w |
W113 F117 |
W34 F38 |
|
|
|
|