Structure of PDB 7nww Chain w

Receptor sequence
>7nwww (length=83) Species: 562 (Escherichia coli) [Search protein sequence]
PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAV
HNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHA
3D structure
PDB7nww A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
Chainw
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna w P2 R3 S4 L5 K6 K7 F10 H14 K18 W34 R36 R37 H52 N53 G54 R55 G72 E73 T77 R78 T79 Y80 H83 P1 R2 S3 L4 K5 K6 F9 H13 K17 W33 R35 R36 H51 N52 G53 R54 G71 E72 T76 R77 T78 Y79 H82
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Feb 21 00:52:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nww', asym_id = 'w', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nww', asym_id='w', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '7nww', asym_id = 'w'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='7nww', asym_id='w')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>