Structure of PDB 7btb Chain w

Receptor sequence
>7btbw (length=182) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNV
QLLINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKA
KAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQW
LVEVIDPRTLNRAERKRLVKKNEKQQRRNMKN
3D structure
PDB7btb Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
Chainw
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w W114 F117 K121 I123 E127 R128 K131 W145 G146 Y147 K148 G149 N151 K152 R184 L187 N191 Q194 Q195 R197 N198 W106 F109 K113 I115 E119 R120 K123 W137 G138 Y139 K140 G141 N143 K144 R165 L168 N172 Q175 Q176 R178 N179
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0034399 nuclear periphery

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7btb, PDBe:7btb, PDBj:7btb
PDBsum7btb
PubMed33037216
UniProtQ08746|RRS1_YEAST Regulator of ribosome biosynthesis (Gene Name=RRS1)

[Back to BioLiP]