Structure of PDB 6osk Chain w

Receptor sequence
>6oskw (length=66) Species: 562 (Escherichia coli) [Search protein sequence]
FCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI
KRARYLSLLPYTDRHQ
3D structure
PDB6osk The structural basis for release-factor activation during translation termination revealed by time-resolved cryogenic electron microscopy.
Chainw
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w K38 I39 P41 S42 K50 Q52 R53 K60 R61 R63 Y64 Y70 R73 H74 K29 I30 P32 S33 K41 Q43 R44 K51 R52 R54 Y55 Y61 R64 H65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osk, PDBe:6osk, PDBj:6osk
PDBsum6osk
PubMed31189921
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]