Structure of PDB 6enu Chain w

Receptor sequence
>6enuw (length=188) Species: 562 (Escherichia coli) [Search protein sequence]
MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGT
RVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAI
GDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTG
GKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK
3D structure
PDB6enu Structural Basis for Polyproline-Mediated Ribosome Stalling and Rescue by the Translation Elongation Factor EF-P.
Chainw
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w G144 D145 K163 F167 R186 G144 D145 K163 F167 R186
BS02 rna w D145 T146 A147 G148 D145 T146 A147 G148
BS03 rna w X34 Q36 F38 R40 R44 R51 K57 X34 Q36 F38 R40 R44 R51 K57
BS04 rna w V30 K31 X34 F130 F167 Y183 V30 K31 X34 F130 F167 Y183
Gene Ontology
Molecular Function
GO:0003746 translation elongation factor activity
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0043043 peptide biosynthetic process
GO:0072344 rescue of stalled ribosome
GO:2001125 negative regulation of translational frameshifting
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6enu, PDBe:6enu, PDBj:6enu
PDBsum6enu
PubMed29100052
UniProtP0A6N4|EFP_ECOLI Elongation factor P (Gene Name=efp)

[Back to BioLiP]