Structure of PDB 6c4i Chain w

Receptor sequence
>6c4iw (length=46) Species: 562 (Escherichia coli) [Search protein sequence]
MSRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
3D structure
PDB6c4i Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
Chainw
Resolution3.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w K8 Q10 I11 K12 D13 N14 A18 H21 K8 Q10 I11 K12 D13 N14 A18 H21
BS02 rna w T7 H21 R26 Q27 R28 E30 K34 K36 G37 Y39 R41 K44 H45 T7 H21 R26 Q27 R28 E30 K34 K36 G37 Y39 R41 K44 H45
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:6c4i, PDBe:6c4i, PDBj:6c4i
PDBsum6c4i
PubMed29403017
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]