Structure of PDB 5u4i Chain w

Receptor sequence
>5u4iw (length=47) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHGNR
3D structure
PDB5u4i Structural basis of co-translational quality control by ArfA and RF2 bound to ribosome.
Chainw
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna w K8 Q10 K12 D13 N14 E17 A18 H21 K7 Q9 K11 D12 N13 E16 A17 H20
BS02 rna w T7 K8 H21 D22 R26 Q27 R28 V29 E30 N32 K33 K34 K36 G37 Y39 R41 K42 K44 H45 T6 K7 H20 D21 R25 Q26 R27 V28 E29 N31 K32 K33 K35 G36 Y38 R40 K41 K43 H44
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:5u4i, PDBe:5u4i, PDBj:5u4i
PDBsum5u4i
PubMed28077875
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]