Structure of PDB 5t5h Chain w

Receptor sequence

>5t5hw (length=215) Species: 5693 (Trypanosoma cruzi)

KAIAANKAARVALKKAAYARGLRYSREYRSAEKKLVHLRRQAKSCGNYYL
EAKPKVAVVTRIRGIAKVAPKQRKILQLLRLRQIFNTVFVRLNKPMENML
RAVEPYIAYGYPSLRTVRMMVYKRGHLKINGQRVKIVNNQMIESKYNNEN
IVCAEDIVNQIYTGGKHFREVTNGLWPFKLSPPAGGMRQKRRHFVEGGDY
GNRDALINRFLARMI

3D structure

• PDB: 5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.
• Chain: w
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	w	R67 K70 R90 G91 I92 A93 K94 P97 K98 R100 K101 I102 L105 R107 Q110 I111 R118 K121 P122 N125 R142 R151 N157 Q159 R160 R196 N200 K206 L207 S208 P209 G212 G213 M214 K217 R218 R236	R40 K43 R63 G64 I65 A66 K67 P70 K71 R73 K74 I75 L78 R80 Q83 I84 R91 K94 P95 N98 R115 R124 N130 Q132 R133 R169 N173 K179 L180 S181 P182 G185 G186 M187 K190 R191 R209
BS02	rna	w	E131 R218 R219 H220 V222 E223 Y227	E104 R191 R192 H193 V195 E196 Y200

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

External links

• PDB: RCSB:5t5h, PDBe:5t5h, PDBj:5t5h
• PDBsum: 5t5h
• PubMed: 27791004
• UniProt: Q4DNZ7