Structure of PDB 5ool Chain w

Receptor sequence

>5oolw (length=79) Species: 9606 (Homo sapiens) [Search protein sequence]

LTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAME
DEFGFEIPDIDAEKLMCPQEIVDYIADKK

3D structure

PDB

5ool Structures of the human mitochondrial ribosome in native states of assembly.

Chain

Resolution

3.06 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	w	D111 S112	D38 S39

Gene Ontology

	Molecular Function
GO:0000035	acyl binding
GO:0000036	acyl carrier activity
GO:0005504	fatty acid binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0140978	mitochondrial large ribosomal subunit binding

	Biological Process
GO:0006120	mitochondrial electron transport, NADH to ubiquinone
GO:0006633	fatty acid biosynthetic process
GO:0009060	aerobic respiration
GO:0009249	protein lipoylation
GO:0016226	iron-sulfur cluster assembly
GO:0032981	mitochondrial respiratory chain complex I assembly
GO:0042776	proton motive force-driven mitochondrial ATP synthesis
GO:0044571	[2Fe-2S] cluster assembly

	Cellular Component
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0031966	mitochondrial membrane
GO:0045271	respiratory chain complex I
GO:0099128	mitochondrial [2Fe-2S] assembly complex
GO:1902494	catalytic complex
GO:1990229	iron-sulfur cluster assembly complex

External links

PDB	RCSB:5ool, PDBe:5ool, PDBj:5ool
PDBsum	5ool
PubMed	28892042
UniProt	O14561\|ACPM_HUMAN Acyl carrier protein, mitochondrial (Gene Name=NDUFAB1)