Structure of PDB 6h58 Chain vv

Receptor sequence
>6h58vv (length=55) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMAD
RVVMA
3D structure
PDB6h58 Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.
Chainvv
Resolution7.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna vv R3 K5 R8 R11 Q14 R15 Q18 R24 S25 K26 Y31 Q32 W44 R45 M48 R51 R3 K5 R8 R11 Q14 R15 Q18 R24 S25 K26 Y31 Q32 W44 R45 M48 R51
Gene Ontology
Molecular Function
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0022611 dormancy process
GO:0032055 negative regulation of translation in response to stress
GO:0033554 cellular response to stress
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h58, PDBe:6h58, PDBj:6h58
PDBsum6h58
PubMed30177741
UniProtP0AFW2|RMF_ECOLI Ribosome modulation factor (Gene Name=rmf)

[Back to BioLiP]