Structure of PDB 8ip9 Chain va

Receptor sequence

>8ip9va (length=128) Species: 4565 (Triticum aestivum) [Search protein sequence]

GRRILNDALRTMVNAERRGKATAQLQPISGVMISFLNIMKHRGYIKNFEV
FDPHRVGKITVELQGRIKDCKALTYRQDLRATEIEKYRTRMLPTRQWGYV
VVTTPNGVLDHEEAIRQNVGGQVLGYFH

3D structure

PDB

8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	va	G2 R3 R4 I5 N7 R11 N15 R18 R19 Q27 I29 S30 R56 V57 K59 D70 K72 A73 L74 T75 R77 D79 R81 A82 K87 R91 T104 T105 P106 R117 Q118 G121 Q123 Y127	G1 R2 R3 I4 N6 R10 N14 R17 R18 Q26 I28 S29 R55 V56 K58 D69 K71 A72 L73 T74 R76 D78 R80 A81 K86 R90 T103 T104 P105 R116 Q117 G120 Q122 Y126

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links